PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA15239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 100aa    MW: 11459.2 Da    PI: 10.8596
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA15239genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.31.2e-262071152
                    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52
                               +prlrWtpeLHe Fv+ ve LGG++kA Pk+il++m+vkgL ++h+kSHLQ 
  Tp57577_TGAC_v2_mRNA15239 20 QPRLRWTPELHEYFVQTVEGLGGKHKASPKHILNMMQVKGLRISHIKSHLQV 71
                               59*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.5571777IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-241771IPR009057Homeodomain-like
SuperFamilySSF466891.77E-121873IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-192171IPR006447Myb domain, plants
PfamPF002498.6E-72272IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MKNNNNSKRS GVRKYHKSEQ PRLRWTPELH EYFVQTVEGL GGKHKASPKH ILNMMQVKGL  60
RISHIKSHLQ VHIYSSCSSL IFDQLSINPN LNILKQNLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013459633.12e-40myb-like DNA-binding domain, shaqkyf class protein
SwissprotQ700D95e-22MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A072UUY92e-40A0A072UUY9_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA18G14071.16e-34(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91862839
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.15e-25G2-like family protein